PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_8899_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB
Protein Properties Length: 520aa    MW: 56586.8 Da    PI: 6.1993
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_8899_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.18.6e-183784148
                                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                         +g+WT  Ed +lv++v+++G g+W+++ ++ g+ R++k+c++rw ++l
  cra_locus_8899_iso_1_len_2004_ver_3 37 KGPWTSAEDAILVEYVTKHGEGNWNAVQKHSGLARCGKSCRLRWANHL 84
                                         79******************************************9986 PP

2Myb_DNA-binding49.51e-1590133146
                                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
                      Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                          +g++T++E+ +++++++++G++ W++ a++++ gRt++++k++w++
  cra_locus_8899_iso_1_len_2004_ver_3  90 KGAFTADEERRIIELHAKMGNK-WARMAAELP-GRTDNEIKNYWNT 133
                                          799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.1553284IPR017930Myb domain
SuperFamilySSF466891.39E-2935131IPR009057Homeodomain-like
SMARTSM007171.7E-133686IPR001005SANT/Myb domain
PfamPF002493.9E-153784IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.4E-243891IPR009057Homeodomain-like
CDDcd001674.84E-113984No hitNo description
PROSITE profilePS5129425.42885139IPR017930Myb domain
SMARTSM007171.2E-1589137IPR001005SANT/Myb domain
PfamPF002491.5E-1490133IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.7E-2592138IPR009057Homeodomain-like
CDDcd001672.29E-1192133No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009751Biological Processresponse to salicylic acid
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045926Biological Processnegative regulation of growth
GO:0048235Biological Processpollen sperm cell differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 520 aa     Download sequence    Send to blast
MTRENEDQMV NKGGISSPSA EEGSGGGNVG GSGPLKKGPW TSAEDAILVE YVTKHGEGNW  60
NAVQKHSGLA RCGKSCRLRW ANHLRPDLKK GAFTADEERR IIELHAKMGN KWARMAAELP  120
GRTDNEIKNY WNTRIKRRQR AGLPIYPPDI CLQALHENRQ SEHISAFSSG NPQHPDLLPI  180
NSFEIPAVEF KNLEFNHQMY PPPLIDIPAR NLLDIPASNL LAPGVNSSYA SKGMLSTVPA  240
TKRPRQLEPL FSGLSSSFNT SFTSCNKYQN DGSQQTVQSF GFSSAYDQNP TSDHPSSSFV  300
LPGSHALLNG NPSSSEPTWA MKLELPSLQT QMGSWGSPSS PLPSLESVDT LIQSPPNEQT  360
HSGSLSPRNS GLLDAVLYES QSMKNIKNSP GQQISSASMV QGEVMDNSSP DHHETEWEVY  420
GDPISPLGHS AASVFSKYTP ISGSSSDEPP TFETTPGSKV KQEGGDLVPV EYGGKDETSN  480
SNQMIFSRPD FLLASNCFGP QIDHSKGPLH AERCSWGTSW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-31351385107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00348DAPTransfer from AT3G11440Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016484620.10.0PREDICTED: transcription factor GAMYB-like isoform X1
RefseqXP_016484621.10.0PREDICTED: transcription factor GAMYB-like isoform X2
SwissprotA2WW871e-106GAM1_ORYSI; Transcription factor GAMYB
TrEMBLA0A068UQ740.0A0A068UQ74_COFCA; Uncharacterized protein
STRINGSolyc06g073640.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA20212358